![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.112: Phoshotransferase/anion transport protein [55803] (1 superfamily) beta-alpha(2)-beta(3)-alpha(3); 3 layers, alpha/beta/alpha; mixed sheet: order 1342; loop crossing |
![]() | Superfamily d.112.1: Phoshotransferase/anion transport protein [55804] (3 families) ![]() |
![]() | Family d.112.1.1: IIA domain of mannitol-specific and ntr phosphotransferase EII [55805] (4 proteins) automatically mapped to Pfam PF00359 |
![]() | Protein Nitrogen regulatory bacterial protein IIa-ntr [55806] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [55807] (1 PDB entry) |
![]() | Domain d1a6jb_: 1a6j B: [40916] complexed with bme, so4 |
PDB Entry: 1a6j (more details), 2.35 Å
SCOPe Domain Sequences for d1a6jb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a6jb_ d.112.1.1 (B:) Nitrogen regulatory bacterial protein IIa-ntr {Escherichia coli [TaxId: 562]} mtnndttlqlssvlnrectrsrvhcqskkraleiiselaakqlslppqvvfeailtrekm gstgigngiaiphgkleedtlravgvfvqletpiafdaidnqpvdllfallvpadqtkth lhtlslvakrladkticrrlraaqsdeelyqiitdte
Timeline for d1a6jb_: