PDB entry 1a6j

View 1a6j on RCSB PDB site
Description: nitrogen regulatory bacterial protein iia-nitrogen
Class: phosphotransferase system
Keywords: phosphotransferase system, nitrogen regulation
Deposited on 1998-02-25, released 1998-07-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.197
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nitrogen regulatory iia protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a6ja_
  • Chain 'B':
    Compound: nitrogen regulatory iia protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a6jb_
  • Heterogens: SO4, BME, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1a6jA (A:)
    mtnndttlqlssvlnrectrsrvhcqskkraleiiselaakqlslppqvvfeailtrekm
    gstgigngiaiphgkleedtlravgvfvqletpiafdaidnqpvdllfallvpadqtkth
    lhtlslvakrladkticrrlraaqsdeelyqiitdtegtpdea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a6jA (A:)
    lqlssvlnrectrsrvhcqskkraleiiselaakqlslppqvvfeailtrekmgstgign
    giaiphgkleedtlravgvfvqletpiafdaidnqpvdllfallvpadqtkthlhtlslv
    akrladkticrrlraaqsdeelyqiitdte
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1a6jB (B:)
    mtnndttlqlssvlnrectrsrvhcqskkraleiiselaakqlslppqvvfeailtrekm
    gstgigngiaiphgkleedtlravgvfvqletpiafdaidnqpvdllfallvpadqtkth
    lhtlslvakrladkticrrlraaqsdeelyqiitdtegtpdea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a6jB (B:)
    mtnndttlqlssvlnrectrsrvhcqskkraleiiselaakqlslppqvvfeailtrekm
    gstgigngiaiphgkleedtlravgvfvqletpiafdaidnqpvdllfallvpadqtkth
    lhtlslvakrladkticrrlraaqsdeelyqiitdte