Lineage for d3nula_ (3nul A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1665312Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 1665313Superfamily d.110.1: Profilin (actin-binding protein) [55770] (2 families) (S)
    alpha-beta(2)-alpha-beta(5)-alpha
  5. 1665314Family d.110.1.1: Profilin (actin-binding protein) [55771] (2 proteins)
    automatically mapped to Pfam PF00235
  6. 1665315Protein Profilin (actin-binding protein) [55772] (8 species)
  7. 1665353Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [55779] (2 PDB entries)
  8. 1665354Domain d3nula_: 3nul A: [40891]
    complexed with gol, so4

Details for d3nula_

PDB Entry: 3nul (more details), 1.6 Å

PDB Description: Profilin I from Arabidopsis thaliana
PDB Compounds: (A:) profilin I

SCOPe Domain Sequences for d3nula_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nula_ d.110.1.1 (A:) Profilin (actin-binding protein) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
swqsyvddhlmcdvegnhltaaailgqdgsvwaqsakfpqlkpqeidgikkdfeepgfla
ptglflggekymviqgeqgavirgkkgpggvtikktnqalvfgfydepmtggqcnlvver
lgdyliesel

SCOPe Domain Coordinates for d3nula_:

Click to download the PDB-style file with coordinates for d3nula_.
(The format of our PDB-style files is described here.)

Timeline for d3nula_: