![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
![]() | Superfamily d.110.1: Profilin (actin-binding protein) [55770] (2 families) ![]() alpha-beta(2)-alpha-beta(5)-alpha |
![]() | Family d.110.1.1: Profilin (actin-binding protein) [55771] (2 proteins) |
![]() | Protein Profilin (actin-binding protein) [55772] (8 species) |
![]() | Species Acanthamoeba castellanii [TaxId:5755] [55776] (5 PDB entries) |
![]() | Domain d2acga_: 2acg A: [40886] |
PDB Entry: 2acg (more details), 2.5 Å
SCOPe Domain Sequences for d2acga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2acga_ d.110.1.1 (A:) Profilin (actin-binding protein) {Acanthamoeba castellanii [TaxId: 5755]} swqtyvdtnlvgtgavtqaaiighdgntwatsagfavspangaalanafkdatairsngf elagtryvtiraddrsvygkkgsagvitvktskailigvynekiqpgtaanvvekladyl igqgf
Timeline for d2acga_: