Lineage for d1d1ja_ (1d1j A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1665312Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 1665313Superfamily d.110.1: Profilin (actin-binding protein) [55770] (2 families) (S)
    alpha-beta(2)-alpha-beta(5)-alpha
  5. 1665314Family d.110.1.1: Profilin (actin-binding protein) [55771] (2 proteins)
    automatically mapped to Pfam PF00235
  6. 1665315Protein Profilin (actin-binding protein) [55772] (8 species)
  7. 1665345Species Human (Homo sapiens), isoform II [TaxId:9606] [55775] (1 PDB entry)
  8. 1665346Domain d1d1ja_: 1d1j A: [40878]
    complexed with pg5, pg6, so4

Details for d1d1ja_

PDB Entry: 1d1j (more details), 2.2 Å

PDB Description: crystal structure of human profilin ii
PDB Compounds: (A:) profilin II

SCOPe Domain Sequences for d1d1ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d1ja_ d.110.1.1 (A:) Profilin (actin-binding protein) {Human (Homo sapiens), isoform II [TaxId: 9606]}
agwqsyvdnlmcdgccqeaaivgycdakyvwaataggvfqsitpieidmivgkdregfft
ngltlgakkcsvirdslyvdgdctmdirtksqggeptynvavgragralvivmgkegvhg
gtlnkkayelalylrrsd

SCOPe Domain Coordinates for d1d1ja_:

Click to download the PDB-style file with coordinates for d1d1ja_.
(The format of our PDB-style files is described here.)

Timeline for d1d1ja_: