SCOP 1.57: Domain d1db0b2: 1db0 B:533-628

Lineage for d1db0b2 (1db0 B:533-628)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.109: Actin depolymerizing proteins [55752] (1 superfamily)

4. Superfamily d.109.1: Actin depolymerizing proteins [55753] (2 families)

5. Family d.109.1.1: Gelsolin-like [55754] (3 proteins)

6. Protein Gelsolin [55759] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55761] (10 PDB entries)

8. Domain d1db0b2: 1db0 B:533-628 [40855]
   Other proteins in same PDB: d1db0a1, d1db0a2

Details for d1db0b2

PDB Entry: 1db0, 3.4 Å

PDB Description: carboxy-terminal half of gelsolin (g4-g6) bound to actin

SCOP Domain Sequences for d1db0b2:

Sequence; same for both SEQRES and ATOM records:

>d1db0b2 d.109.1.1 (B:533-628) Gelsolin {Human (Homo sapiens)}
pastrlfqvransagatraveiipkagalnsndafvlktpsaaylwvgtgaseaektgaq
ellrvlraqpvqvaegsepdsfwealggkaayrtsp

Timeline for d1db0b2:

• d1db0b2 first appeared (with stable ids) in SCOP 1.55
  
• d1db0b2 appears in SCOP 1.59
  
• d1db0b2 last appears in SCOP 1.61