SCOP 1.57: Domain d1db0a2: 1db0 A:147-375

Lineage for d1db0a2 (1db0 A:147-375)

1. Root: SCOP 1.57

2. Class c: Alpha and beta proteins (a/b) [51349] (107 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (5 families)

5. Family c.55.1.1: Actin/HSP70 [53068] (4 proteins)

6. Protein Actin [53073] (5 species)

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53075] (5 PDB entries)

8. Domain d1db0a2: 1db0 A:147-375 [33440]
   Other proteins in same PDB: d1db0b1, d1db0b2, d1db0b3

Details for d1db0a2

PDB Entry: 1db0, 3.4 Å

PDB Description: carboxy-terminal half of gelsolin (g4-g6) bound to actin

SCOP Domain Sequences for d1db0a2:

Sequence; same for both SEQRES and ATOM records:

>d1db0a2 c.55.1.1 (A:147-375) Actin {Rabbit (Oryctolagus cuniculus)}
rttgivldsgdgvthnvpiyegyalphaimrldlagrdltdylmkiltergysfvttaer
eivrdikeklcyvaldfenemataassssleksyelpdgqvitignerfrcpetlfqpsf
igmesagihettynsimkcdidirkdlyannvmsggttmypgiadrmqkeitalapstmk
ikiiapperkysvwiggsilaslstfqqmwitkqeydeagpsivhrkcf

Timeline for d1db0a2:

• d1db0a2 first appeared (with stable ids) in SCOP 1.55
  
• d1db0a2 appears in SCOP 1.59
  
• d1db0a2 last appears in SCOP 1.61