SCOPe 2.04: Domain d1dejs_: 1dej S:

Lineage for d1dejs_ (1dej S:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.109: Gelsolin-like [55752] (3 superfamilies)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families)

5. Family d.109.1.1: Gelsolin-like [55754] (5 proteins)

6. Protein Gelsolin [55759] (2 species)
   consists of six similar domains

7. Species Human (Homo sapiens) [TaxId:9606] [55761] (31 PDB entries)
   Uniprot P20065 55-179

8. Domain d1dejs_: 1dej S: [40850]
   Other proteins in same PDB: d1deja1, d1deja2
   domain 1
   complexed with atp, ca; mutant

Details for d1dejs_

PDB Entry: 1dej, 2.4 Å

PDB Description: crystal structure of a dictyostelium/tetrahymena chimera actin (mutant 646: q228k/t229a/a230y/a231k/s232e/e360h) in complex with human gelsolin segment 1

PDB Compounds: (S:) gelsolin

SCOPe Domain Sequences for d1dejs_:

Sequence; same for both SEQRES and ATOM records:

>d1dejs_ d.109.1.1 (S:) Gelsolin {Human (Homo sapiens) [TaxId: 9606]}
mgsvvehpeflkagkepglqiwrvekfdlvpvptclygdfftgdayvilktvqlrngnlq
ydlhywlgnecsqdesgaaaiftvqlddylngravqhrevqgfesatflgyfksglkykk
ggvasgf

Timeline for d1dejs_:

• d1dejs_ first appeared (with stable ids) in SCOP 1.55
  
• d1dejs_ appears in SCOPe 2.03
  
• d1dejs_ appears in SCOPe 2.05
  
• d1dejs_ appears in the current release, SCOPe 2.08