SCOPe 2.06: Domain d1svya_: 1svy A:

Lineage for d1svya_ (1svy A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.109: Gelsolin-like [55752] (3 superfamilies)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families)

5. Family d.109.1.1: Gelsolin-like [55754] (5 proteins)

6. Protein Severin, domain 2 [55757] (1 species)

7. Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [55758] (3 PDB entries)

8. Domain d1svya_: 1svy A: [40831]
   complexed with ca, na

Details for d1svya_

PDB Entry: 1svy, 1.75 Å

PDB Description: severin domain 2, 1.75 angstrom crystal structure

PDB Compounds: (A:) severin

SCOPe Domain Sequences for d1svya_:

Sequence; same for both SEQRES and ATOM records:

>d1svya_ d.109.1.1 (A:) Severin, domain 2 {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
eykprllhisgdknakvaevplatsslnsgdcflldagltiyqfngsksspqeknkaaev
araidaerkglpkvevfcetdsdipaefwkllggkgaiaakh

Timeline for d1svya_:

• d1svya_ first appeared (with stable ids) in SCOP 1.55, called d1svy__
  
• d1svya_ appears in SCOPe 2.05
  
• d1svya_ appears in SCOPe 2.07
  
• d1svya_ appears in the current release, SCOPe 2.08