Lineage for d1nmtb2 (1nmt B:225-451)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1664276Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 1664277Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 1664677Family d.108.1.2: N-myristoyl transferase, NMT [55748] (1 protein)
    duplication: consists of two NAT-like domains swapped with the C-terminal strands
  6. 1664678Protein N-myristoyl transferase, NMT [55749] (3 species)
  7. 1664697Species Yeast (Candida albicans) [TaxId:5476] [55751] (3 PDB entries)
  8. 1664705Domain d1nmtb2: 1nmt B:225-451 [40826]
    complexed with gol

Details for d1nmtb2

PDB Entry: 1nmt (more details), 2.45 Å

PDB Description: n-myristoyl transferase from candida albicans at 2.45 a
PDB Compounds: (B:) n-myristoyl transferase

SCOPe Domain Sequences for d1nmtb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nmtb2 d.108.1.2 (B:225-451) N-myristoyl transferase, NMT {Yeast (Candida albicans) [TaxId: 5476]}
yqhrpinwsklhdvgfshlppnqtkssmvasytlpnnpklkglrpmtgkdvstvlsllyk
yqerfdivqlfteeefkhwmlghdensdsnvvksyvvedengiitdyfsyyllpftvldn
aqhdelgiaylfyyasdsfekpnykkrlnelitdalitskkfgvdvfncltcqdntyflk
dckfgsgdgflnyylfnyrtfpmdggidkktkevvedqtsgigvvll

SCOPe Domain Coordinates for d1nmtb2:

Click to download the PDB-style file with coordinates for d1nmtb2.
(The format of our PDB-style files is described here.)

Timeline for d1nmtb2: