Lineage for d2nmta1 (2nmt A:34-218)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 195555Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
  4. 195556Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (3 families) (S)
  5. 195633Family d.108.1.2: N-myristoyl transferase, NMT [55748] (1 protein)
  6. 195634Protein N-myristoyl transferase, NMT [55749] (2 species)
  7. 195635Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55750] (3 PDB entries)
  8. 195642Domain d2nmta1: 2nmt A:34-218 [40821]

Details for d2nmta1

PDB Entry: 2nmt (more details), 2.9 Å

PDB Description: myristoyl-coa:protein n-myristoyltransferase bound to myristoyl-coa and peptide analogs

SCOP Domain Sequences for d2nmta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nmta1 d.108.1.2 (A:34-218) N-myristoyl transferase, NMT {Baker's yeast (Saccharomyces cerevisiae)}
amkdhkfwrtqpvkdfdekvveegpidkpktpedisdkplpllssfewcsidvdnkkqle
dvfvllnenyvedrdagfrfnytkeffnwalkspgwkkdwhigvrvketqklvafisaip
vtlgvrgkqvpsveinflcvhkqlrskrltpvlikeitrrvnkcdiwhalytagivlpap
vstcr

SCOP Domain Coordinates for d2nmta1:

Click to download the PDB-style file with coordinates for d2nmta1.
(The format of our PDB-style files is described here.)

Timeline for d2nmta1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2nmta2