Lineage for d1cjwa_ (1cjw A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2968378Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2968379Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) (S)
  5. 2968380Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 2968711Protein Serotonin N-acetyltranferase [55746] (1 species)
  7. 2968712Species Sheep (Ovis aries) [TaxId:9940] [55747] (7 PDB entries)
  8. 2968713Domain d1cjwa_: 1cjw A: [40818]
    complexed with cot

Details for d1cjwa_

PDB Entry: 1cjw (more details), 1.8 Å

PDB Description: serotonin n-acetyltransferase complexed with a bisubstrate analog
PDB Compounds: (A:) protein (serotonin n-acetyltransferase)

SCOPe Domain Sequences for d1cjwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cjwa_ d.108.1.1 (A:) Serotonin N-acetyltranferase {Sheep (Ovis aries) [TaxId: 9940]}
htlpanefrcltpedaagvfeiereafisvsgncplnldevqhfltlcpelslgwfvegr
lvafiigslwdeerltqeslalhrprghsahlhalavhrsfrqqgkgsvllwrylhhvga
qpavrravlmcedalvpfyqrfgfhpagpcaivvgsltftemhcsl

SCOPe Domain Coordinates for d1cjwa_:

Click to download the PDB-style file with coordinates for d1cjwa_.
(The format of our PDB-style files is described here.)

Timeline for d1cjwa_: