Lineage for d1bob__ (1bob -)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 83053Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
  4. 83054Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (2 families) (S)
  5. 83055Family d.108.1.1: N-acetyl transferase, NAT [55730] (9 proteins)
  6. 83095Protein Histone acetyltransferase HAT1 [55742] (1 species)
  7. 83096Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55743] (1 PDB entry)
  8. 83097Domain d1bob__: 1bob - [40816]

Details for d1bob__

PDB Entry: 1bob (more details), 2.3 Å

PDB Description: histone acetyltransferase hat1 from saccharomyces cerevisiae in complex with acetyl coenzyme a

SCOP Domain Sequences for d1bob__:

Sequence, based on SEQRES records: (download)

>d1bob__ d.108.1.1 (-) Histone acetyltransferase HAT1 {Baker's yeast (Saccharomyces cerevisiae)}
fkpetwtssanealrvsivgenavqfsplftypiygdsekiygykdliihlafdsvtfkp
yvnvkysaklgddnivdvekkllsflpkddvivrdeakwvdcfaeerkthnlsdvfekvs
eyslngeefvvyksslvddfarrmhrrvqifsllfieaanyidetdpswqiywllnkktk
eligfvttykywhylgaksfdedidkkfrakisqflifppyqnkghgsclyeaiiqswle
dksiteitvedpneafddlrdrndiqrlrklgydavfqkhsdlsdeflessrkslkleer
qfnrlvemllllnns

Sequence, based on observed residues (ATOM records): (download)

>d1bob__ d.108.1.1 (-) Histone acetyltransferase HAT1 {Baker's yeast (Saccharomyces cerevisiae)}
fkpetwtssanealrvsivgenavqfsplftypiygdsekiygykdliihlafdsvtfkp
yvnvkysaklgddnivdvekkllsflpkddvivrdeakwvdcfaeerkthnlsdvfekvs
eyslngeefvvyksslvddfarrmhrrvqifsllfieaanyidetdpswqiywllnkktk
eligfvttykywhyidkkfrakisqflifppyqnkghgsclyeaiiqswledksiteitv
edpneafddlrdrndiqrlrklgydavfqkhsdlsdeflessrkslkleerqfnrlveml
lllnns

SCOP Domain Coordinates for d1bob__:

Click to download the PDB-style file with coordinates for d1bob__.
(The format of our PDB-style files is described here.)

Timeline for d1bob__: