PDB entry 1bob

View 1bob on RCSB PDB site
Description: histone acetyltransferase hat1 from saccharomyces cerevisiae in complex with acetyl coenzyme a
Deposited on 1998-07-02, released 1999-04-20
The last revision prior to the SCOP 1.57 freeze date was dated 1999-04-20, with a file datestamp of 1999-04-19.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.204
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d1bob__

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1bob_ (-)
    fkpetwtssanealrvsivgenavqfsplftypiygdsekiygykdliihlafdsvtfkp
    yvnvkysaklgddnivdvekkllsflpkddvivrdeakwvdcfaeerkthnlsdvfekvs
    eyslngeefvvyksslvddfarrmhrrvqifsllfieaanyidetdpswqiywllnkktk
    eligfvttykywhylgaksfdedidkkfrakisqflifppyqnkghgsclyeaiiqswle
    dksiteitvedpneafddlrdrndiqrlrklgydavfqkhsdlsdeflessrkslkleer
    qfnrlvemllllnns
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bob_ (-)
    fkpetwtssanealrvsivgenavqfsplftypiygdsekiygykdliihlafdsvtfkp
    yvnvkysaklgddnivdvekkllsflpkddvivrdeakwvdcfaeerkthnlsdvfekvs
    eyslngeefvvyksslvddfarrmhrrvqifsllfieaanyidetdpswqiywllnkktk
    eligfvttykywhyidkkfrakisqflifppyqnkghgsclyeaiiqswledksiteitv
    edpneafddlrdrndiqrlrklgydavfqkhsdlsdeflessrkslkleerqfnrlveml
    lllnns