![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
![]() | Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) ![]() |
![]() | Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins) |
![]() | Protein Histone acetyltransferase HPA2 [55740] (1 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55741] (2 PDB entries) |
![]() | Domain d1qsob_: 1qso B: [40813] |
PDB Entry: 1qso (more details), 2.9 Å
SCOPe Domain Sequences for d1qsob_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qsob_ d.108.1.1 (B:) Histone acetyltransferase HPA2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} nitvrfvtendkegwqrlwksyqdfyevsfpddlddfnfgrfldpnikmwaavavessse kiigminffnhmttwdfkdkiyindlyvdensrvkgaggkliqfvydeadklgtpsvywc tdesnhraqllyvkvgykapkilykrkgy
Timeline for d1qsob_: