Lineage for d1qsob_ (1qso B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2968378Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2968379Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) (S)
  5. 2968380Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 2968491Protein Histone acetyltransferase HPA2 [55740] (1 species)
  7. 2968492Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55741] (2 PDB entries)
  8. 2968498Domain d1qsob_: 1qso B: [40813]

Details for d1qsob_

PDB Entry: 1qso (more details), 2.9 Å

PDB Description: Histone Acetyltransferase HPA2 from Saccharomyces Cerevisiae
PDB Compounds: (B:) hpa2 histone acetyltransferase

SCOPe Domain Sequences for d1qsob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qsob_ d.108.1.1 (B:) Histone acetyltransferase HPA2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
nitvrfvtendkegwqrlwksyqdfyevsfpddlddfnfgrfldpnikmwaavavessse
kiigminffnhmttwdfkdkiyindlyvdensrvkgaggkliqfvydeadklgtpsvywc
tdesnhraqllyvkvgykapkilykrkgy

SCOPe Domain Coordinates for d1qsob_:

Click to download the PDB-style file with coordinates for d1qsob_.
(The format of our PDB-style files is described here.)

Timeline for d1qsob_: