SCOPe 2.04: Domain d1qsoa_: 1qso A:

Lineage for d1qsoa_ (1qso A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families)

5. Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)

6. Protein Histone acetyltransferase HPA2 [55740] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55741] (2 PDB entries)

8. Domain d1qsoa_: 1qso A: [40812]

Details for d1qsoa_

PDB Entry: 1qso, 2.9 Å

PDB Description: Histone Acetyltransferase HPA2 from Saccharomyces Cerevisiae

PDB Compounds: (A:) hpa2 histone acetyltransferase

SCOPe Domain Sequences for d1qsoa_:

Sequence; same for both SEQRES and ATOM records:

>d1qsoa_ d.108.1.1 (A:) Histone acetyltransferase HPA2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
nitvrfvtendkegwqrlwksyqdfyevsfpddlddfnfgrfldpnikmwaavavessse
kiigminffnhmttwdfkdkiyindlyvdensrvkgaggkliqfvydeadklgtpsvywc
tdesnhraqllyvkvgykapkilykrkgy

Timeline for d1qsoa_:

• d1qsoa_ first appeared (with stable ids) in SCOP 1.55
  
• d1qsoa_ appears in SCOPe 2.03
  
• d1qsoa_ appears in SCOPe 2.05
  
• d1qsoa_ appears in the current release, SCOPe 2.08