![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
![]() | Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) ![]() |
![]() | Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins) |
![]() | Protein Catalytic domain of GCN5 histone acetyltransferase [55737] (3 species) |
![]() | Species Tetrahymena thermophila [TaxId:5911] [55739] (9 PDB entries) Uniprot Q27198 49-209 |
![]() | Domain d5gcna_: 5gcn A: [40807] complexed with coa |
PDB Entry: 5gcn (more details)
SCOPe Domain Sequences for d5gcna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5gcna_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Tetrahymena thermophila [TaxId: 5911]} mkglldfdiltndgthrnmkllidlknifsrqlpkmpkeyivklvfdrhhesmvilknkq kviggicfrqykpqrfaevaflavtaneqvrgygtrlmnkfkdhmqkqnieylltyadnf aigyfkkqgftkehrmpqekwkgyikdydggtlmecyihpyvdygn
Timeline for d5gcna_: