Lineage for d1qsta_ (1qst A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1921278Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 1921279Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 1921280Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 1921314Protein Catalytic domain of GCN5 histone acetyltransferase [55737] (3 species)
  7. 1921320Species Tetrahymena thermophila [TaxId:5911] [55739] (9 PDB entries)
    Uniprot Q27198 49-209
  8. 1921321Domain d1qsta_: 1qst A: [40804]
    complexed with epe

Details for d1qsta_

PDB Entry: 1qst (more details), 1.7 Å

PDB Description: crystal structure of tetrahymena gcn5
PDB Compounds: (A:) tgcn5 histone acetyl transferase

SCOPe Domain Sequences for d1qsta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qsta_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Tetrahymena thermophila [TaxId: 5911]}
ldfdiltndgthrnmkllidlknifsrqlpkmpkeyivklvfdrhhesmvilknkqkvig
gicfrqykpqrfaevaflavtaneqvrgygtrlmnkfkdhmqkqnieylltyadnfaigy
fkkqgftkehrmpqekwkgyikdydggtlmecyihpyvdy

SCOPe Domain Coordinates for d1qsta_:

Click to download the PDB-style file with coordinates for d1qsta_.
(The format of our PDB-style files is described here.)

Timeline for d1qsta_: