Lineage for d1qsta_ (1qst A:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (2 families) 
Family d.108.1.1: N-acetyl transferase, NAT [55730] (8 proteins) 
Protein Catalytic domain of GCN5 histone acetyltransferase [55737] (2 species) Species Tetrahymena thermophila [TaxId:5911] [55739] (4 PDB entries) 
Domain d1qsta_: 1qst A: [40804]
Details for d1qsta_
PDB Entry: 1qst (more details), 1.7 Å
PDB Description: crystal structure of tetrahymena gcn5
SCOP Domain Sequences for d1qsta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qsta_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Tetrahymena thermophila}
ldfdiltndgthrnmkllidlknifsrqlpkmpkeyivklvfdrhhesmvilknkqkvig
gicfrqykpqrfaevaflavtaneqvrgygtrlmnkfkdhmqkqnieylltyadnfaigy
fkkqgftkehrmpqekwkgyikdydggtlmecyihpyvdy
SCOP Domain Coordinates for d1qsta_:
Click to download the PDB-style file with coordinates for d1qsta_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qsta_:
- d1qsta_ appears in SCOP 1.57
- d1qsta_ appears in the current release, SCOPe 2.08
View in 3D