Lineage for d1cm0b_ (1cm0 B:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1037211Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 1037212Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 1037213Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 1037301Protein Histone acetyltransferase domain of P300/CBP associating factor, PCAF [55735] (1 species)
  7. 1037302Species Human (Homo sapiens) [TaxId:9606] [55736] (1 PDB entry)
  8. 1037304Domain d1cm0b_: 1cm0 B: [40801]
    complexed with coa

Details for d1cm0b_

PDB Entry: 1cm0 (more details), 2.3 Å

PDB Description: crystal structure of the pcaf/coenzyme-a complex
PDB Compounds: (B:) p300/cbp associating factor

SCOPe Domain Sequences for d1cm0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cm0b_ d.108.1.1 (B:) Histone acetyltransferase domain of P300/CBP associating factor, PCAF {Human (Homo sapiens) [TaxId: 9606]}
kviefhvvgnslnqkpnkkilmwlvglqnvfshqlprmpkeyitrlvfdpkhktlalikd
grviggicfrmfpsqgfteivfcavtsneqvkgygthlmnhlkeyhikhdilnfltyade
yaigyfkkqgfskeikipktkyvgyikdyegatlmgcelnpr

SCOPe Domain Coordinates for d1cm0b_:

Click to download the PDB-style file with coordinates for d1cm0b_.
(The format of our PDB-style files is described here.)

Timeline for d1cm0b_: