Lineage for d1biaa3 (1bia A:64-270)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2186950Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 2186951Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 2187215Family d.104.1.2: Biotin holoenzyme synthetase [55707] (3 protein domains)
  6. 2187216Protein Biotin repressor/biotin holoenzyme synthetase, catalytic (central) domain [55708] (1 species)
    this structure contains an SH2-like fold
  7. 2187217Species Escherichia coli [TaxId:562] [55709] (4 PDB entries)
  8. 2187218Domain d1biaa3: 1bia A:64-270 [40787]
    Other proteins in same PDB: d1biaa1, d1biaa2

Details for d1biaa3

PDB Entry: 1bia (more details), 2.3 Å

PDB Description: the e. coli biotin holoenzyme synthetase(slash)bio repressor crystal structure delineates the biotin and dna-binding domains
PDB Compounds: (A:) BirA BIFUNCTIONAL PROTEIN

SCOPe Domain Sequences for d1biaa3:

Sequence, based on SEQRES records: (download)

>d1biaa3 d.104.1.2 (A:64-270) Biotin repressor/biotin holoenzyme synthetase, catalytic (central) domain {Escherichia coli [TaxId: 562]}
iqllnakqilgqldggsvavlpvidstnqylldrigelksgdaciaeyqqagrgrrgrkw
fspfganlylsmfwrleqgpaaaiglslvigivmaevlrklgadkvrvkwpndlylqdrk
lagilveltgktgdaaqivigaginmamrrveesvvnqgwitlqeaginldrntlaamli
relraalelfeqeglapylsrwekldn

Sequence, based on observed residues (ATOM records): (download)

>d1biaa3 d.104.1.2 (A:64-270) Biotin repressor/biotin holoenzyme synthetase, catalytic (central) domain {Escherichia coli [TaxId: 562]}
iqllnakqilgqldggsvavlpvidstnqylldrigelksgdaciaeyqqagspfganly
lsmfwrleqpaaaiglslvigivmaevlrklgadkvrvkwpndlylqdrklagilveltg
aaqivigaginmamwitlqeaginldrntlaamlirelraalelfeqeglapylsrwekl
dn

SCOPe Domain Coordinates for d1biaa3:

Click to download the PDB-style file with coordinates for d1biaa3.
(The format of our PDB-style files is described here.)

Timeline for d1biaa3: