PDB entry 1bia

View 1bia on RCSB PDB site
Description: the e. coli biotin holoenzyme synthetase(slash)bio repressor crystal structure delineates the biotin and DNA-binding domains
Class: transcription regulation
Keywords: transcription regulation
Deposited on 1992-07-06, released 1993-10-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.19
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: BirA BIFUNCTIONAL PROTEIN
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1biaa1, d1biaa2, d1biaa3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1biaA (A:)
    mkdntvplkliallangefhsgeqlgetlgmsraainkhiqtlrdwgvdvftvpgkgysl
    pepiqllnakqilgqldggsvavlpvidstnqylldrigelksgdaciaeyqqagrgrrg
    rkwfspfganlylsmfwrleqgpaaaiglslvigivmaevlrklgadkvrvkwpndlylq
    drklagilveltgktgdaaqivigaginmamrrveesvvnqgwitlqeaginldrntlaa
    mlirelraalelfeqeglapylsrwekldnfinrpvkliigdkeifgisrgidkqgalll
    eqdgiikpwmggeislrsaek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1biaA (A:)
    mkdntvplkliallangefhsgeqlgetlgmsraainkhiqtlrdwgvdvftvpgkgysl
    pepiqllnakqilgqldggsvavlpvidstnqylldrigelksgdaciaeyqqagspfga
    nlylsmfwrleqpaaaiglslvigivmaevlrklgadkvrvkwpndlylqdrklagilve
    ltgaaqivigaginmamwitlqeaginldrntlaamlirelraalelfeqeglapylsrw
    ekldnfinrpvkliigdkeifgisrgidkqgallleqdgiikpwmggeislr