Lineage for d1fyfa2 (1fyf A:242-532)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 195363Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
  4. 195364Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (2 families) (S)
  5. 195365Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalyic domain [55682] (12 proteins)
  6. 195495Protein Threonyl-tRNA synthetase (ThrRS) [55694] (1 species)
  7. 195496Species Escherichia coli [TaxId:562] [55695] (5 PDB entries)
  8. 195502Domain d1fyfa2: 1fyf A:242-532 [40755]
    Other proteins in same PDB: d1fyfa1, d1fyfb1

Details for d1fyfa2

PDB Entry: 1fyf (more details), 1.65 Å

PDB Description: crystal structure of a truncated form of threonyl-trna synthetase complexed with a seryl adenylate analog

SCOP Domain Sequences for d1fyfa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fyfa2 d.104.1.1 (A:242-532) Threonyl-tRNA synthetase (ThrRS) {Escherichia coli}
rdhrkigkqldlyhmqeeapgmvfwhndgwtifrelevfvrsklkeyqyqevkgpfmmdr
vlwektghwdnykdamfttssenreycikpmncpghvqifnqglksyrdlplrmaefgsc
hrnepsgslhglmrvrgftqddahifcteeqirdevngcirlvydmystfgfekivvkls
trpekrigsdemwdraeadlavaleennipfeyqlgegafygpkieftlydcldrawqcg
tvqldfslpsrlsasyvgednerkvpvmihrailgsmerfigilteefagf

SCOP Domain Coordinates for d1fyfa2:

Click to download the PDB-style file with coordinates for d1fyfa2.
(The format of our PDB-style files is described here.)

Timeline for d1fyfa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fyfa1