SCOP 1.65: Domain d1evld2: 1evl D:242-532

Lineage for d1evld2 (1evl D:242-532)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (2 families)

5. Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalyic domain [55682] (12 proteins)

6. Protein Threonyl-tRNA synthetase (ThrRS) [55694] (1 species)

7. Species Escherichia coli [TaxId:562] [55695] (5 PDB entries)

8. Domain d1evld2: 1evl D:242-532 [40754]
   Other proteins in same PDB: d1evla1, d1evlb1, d1evlc1, d1evld1
   complexed with tsb, zn

Details for d1evld2

PDB Entry: 1evl, 1.55 Å

PDB Description: crystal structure of a truncated form of threonyl-trna synthetase with a threonyl adenylate analog

SCOP Domain Sequences for d1evld2:

Sequence; same for both SEQRES and ATOM records:

>d1evld2 d.104.1.1 (D:242-532) Threonyl-tRNA synthetase (ThrRS) {Escherichia coli}
rdhrkigkqldlyhmqeeapgmvfwhndgwtifrelevfvrsklkeyqyqevkgpfmmdr
vlwektghwdnykdamfttssenreycikpmncpghvqifnqglksyrdlplrmaefgsc
hrnepsgslhglmrvrgftqddahifcteeqirdevngcirlvydmystfgfekivvkls
trpekrigsdemwdraeadlavaleennipfeyqlgegafygpkieftlydcldrawqcg
tvqldfslpsrlsasyvgednerkvpvmihrailgsmerfigilteefagf

Timeline for d1evld2:

• d1evld2 first appeared (with stable ids) in SCOP 1.55
  
• d1evld2 appears in SCOP 1.63
  
• d1evld2 appears in SCOP 1.67
  
• d1evld2 appears in the current release, SCOPe 2.08