Lineage for d1ggmb2 (1ggm B:1-394)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 195363Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
  4. 195364Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (2 families) (S)
  5. 195365Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalyic domain [55682] (12 proteins)
  6. 195396Protein Glycyl-tRNA synthetase (GlyRS) [55692] (1 species)
  7. 195397Species Thermus thermophilus [TaxId:274] [55693] (3 PDB entries)
  8. 195403Domain d1ggmb2: 1ggm B:1-394 [40750]
    Other proteins in same PDB: d1ggma1, d1ggmb1

Details for d1ggmb2

PDB Entry: 1ggm (more details), 3.4 Å

PDB Description: glycyl-trna synthetase from thermus thermophilus complexed with glycyl-adenylate

SCOP Domain Sequences for d1ggmb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ggmb2 d.104.1.1 (B:1-394) Glycyl-tRNA synthetase (GlyRS) {Thermus thermophilus}
aassldelvalckrrgfifqsseiygglqgvydygplgvelknnlkqawwrrnvyerddm
egldasvlthrlvlhysgheatfadpmvdnakarywtppryfnmmfqdlrgprggrglla
ylrpetaqgifvnfknvldatsrklgfgiaqigkafrneitprnfifrvrefeqmeieyf
vrpgedeywhrywveerlkwwqemglsrenlvpyqqppessahyakatvdilyrfphgsl
elegiaqrtdfdlgshtkdqealgitarvlrnehstqrlayrdpetgkwfvpyviepsag
vdrgvlallaeaftreelpngeerivlklkp

SCOP Domain Coordinates for d1ggmb2:

Click to download the PDB-style file with coordinates for d1ggmb2.
(The format of our PDB-style files is described here.)

Timeline for d1ggmb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ggmb1