SCOPe 2.04: Domain d1adjc2: 1adj C:2-325

Lineage for d1adjc2 (1adj C:2-325)

Root: SCOPe 2.04
Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
contains large mixed beta-sheet
Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families)
Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins)
Protein Histidyl-tRNA synthetase (HisRS) [55688] (4 species)
Species Thermus thermophilus [TaxId:274] [55691] (3 PDB entries)
Domain d1adjc2: 1adj C:2-325 [40739]
Other proteins in same PDB: d1adja1, d1adjb1, d1adjc1, d1adjd1
protein/RNA complex; complexed with his, so4

Details for d1adjc2

PDB Entry: 1adj (more details), 2.7 Å

PDB Description: histidyl-trna synthetase in complex with histidine

PDB Compounds: (C:) histidyl-tRNA synthetase

SCOPe Domain Sequences for d1adjc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1adjc2 d.104.1.1 (C:2-325) Histidyl-tRNA synthetase (HisRS) {Thermus thermophilus [TaxId: 274]}
taravrgtkdlfgkelrmhqrivatarkvleaagalelvtpifeetqvfekgvgaatdiv
rkemftfqdrggrsltlrpegtaamvraylehgmkvwpqpvrlwmagpmfraerpqkgry
rqfhqvnyealgsenpildaeavvllyeclkelglrrlkvklssvgdpedrarynaylre
vlsphrealsedskerleenpmrildskserdqallkelgvrpmldflgeearahlkeve
rhlerlsvpyelepalvrgldyyvrtafevhheeigaqsalggggrydglsellggprvp
gvgfafgvervalaleaegfglpe

SCOPe Domain Coordinates for d1adjc2:

Click to download the PDB-style file with coordinates for d1adjc2.
(The format of our PDB-style files is described here.)

Timeline for d1adjc2: