SCOPe 2.08: Domain d6xayb3: 6xay B:1631-1722

Lineage for d6xayb3 (6xay B:1631-1722)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.0: automated matches [191562] (1 protein)
   not a true family

6. Protein automated matches [190976] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188649] (69 PDB entries)

8. Domain d6xayb3: 6xay B:1631-1722 [407357]
   automated match to d4lxoa1
   complexed with gol

Details for d6xayb3

PDB Entry: 6xay, 2.48 Å

PDB Description: structure of a fragment of human fibronectin containing the 10th, 11th and 12th type iii domains

PDB Compounds: (B:) Fibronectin

SCOPe Domain Sequences for d6xayb3:

Sequence, based on SEQRES records:

>d6xayb3 b.1.2.0 (B:1631-1722) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tipaptdlkftqgtptslsaqwtppnvqltgyrvrvtpkektgpmkeinlapdsssvvvs
glmvatkyevsvyalkdtltsrpaqgvvttle

Sequence, based on observed residues (ATOM records):

>d6xayb3 b.1.2.0 (B:1631-1722) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tipaptdlkftqgtptslsaqwtppnvqltgyrvrvtpkepmkeinlapdsssvvvsglm
vatkyevsvyalkdtltsrpaqgvvttle

Timeline for d6xayb3:

• d6xayb3 first appeared in SCOPe 2.07