Details for d1e3ha5

PDB Entry: 1e3h (more details), 2.6 Å

PDB Description: semet derivative of streptomyces antibioticus pnpase/gpsi enzyme

SCOP Domain Sequences for d1e3ha5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e3ha5 d.101.1.1 (A:152-262) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domains 2 and 5 {Streptomyces antibioticus}
fsgpiggvrvalirgqwvafpthteledavfdmvvagrvledgdvaimmveaeatektiq
lvkdgaeapteevvaagldaakpfikvlckaqadlaakaakptgefpvfld

SCOP Domain Coordinates for d1e3ha5:

Click to download the PDB-style file with coordinates for d1e3ha5.
(The format of our PDB-style files is described here.)

Timeline for d1e3ha5: