Lineage for d1div_2 (1div 1-55)
- Root: SCOP 1.67
Class d: Alpha and beta proteins (a+b) [53931] (260 folds) 
Fold d.100: L9 N-domain-like [55657] (1 superfamily)
beta(2)-alpha-beta-alpha; 3 layers: alpha/beta/alphaSuperfamily d.100.1: L9 N-domain-like [55658] (2 families) 
Family d.100.1.1: Ribosomal protein L9 N-domain [55659] (1 protein) Protein Ribosomal protein L9 N-domain [55660] (1 species) Species Bacillus stearothermophilus [TaxId:1422] [55661] (2 PDB entries) 
Domain d1div_2: 1div 1-55 [40693]
Other proteins in same PDB: d1div_1
Details for d1div_2
PDB Entry: 1div (more details), 2.6 Å
PDB Description: ribosomal protein l9
SCOP Domain Sequences for d1div_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1div_2 d.100.1.1 (1-55) Ribosomal protein L9 N-domain {Bacillus stearothermophilus}
mkviflkdvkgkgkkgeiknvadgyannflfkqglaieatpanlkaleaqkqkeq
SCOP Domain Coordinates for d1div_2:
Click to download the PDB-style file with coordinates for d1div_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1div_2:
- d1div_2 first appeared (with stable ids) in SCOP 1.55
- d1div_2 appears in SCOP 1.65
- d1div_2 appears in SCOP 1.69
- d1div_2 appears in the current release, SCOPe 2.08, called d1diva2
View in 3D
