Lineage for d1div_1 (1div 56-149)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 416544Fold d.99: Ribosomal protein L9 C-domain [55652] (1 superfamily)
    alpha-beta-alpha(2)-beta(2); 2 layers: alpha/beta
  4. 416545Superfamily d.99.1: Ribosomal protein L9 C-domain [55653] (1 family) (S)
  5. 416546Family d.99.1.1: Ribosomal protein L9 C-domain [55654] (1 protein)
  6. 416547Protein Ribosomal protein L9 C-domain [55655] (1 species)
  7. 416548Species Bacillus stearothermophilus [TaxId:1422] [55656] (1 PDB entry)
  8. 416549Domain d1div_1: 1div 56-149 [40692]
    Other proteins in same PDB: d1div_2

Details for d1div_1

PDB Entry: 1div (more details), 2.6 Å

PDB Description: ribosomal protein l9

SCOP Domain Sequences for d1div_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1div_1 d.99.1.1 (56-149) Ribosomal protein L9 C-domain {Bacillus stearothermophilus}
rqaaeelanakklkeqlekltvtipakageggrlfgsitskqiaeslqaqhglkldkrki
eladairalgytnvpvklhpevtatlkvhvteqk

SCOP Domain Coordinates for d1div_1:

Click to download the PDB-style file with coordinates for d1div_1.
(The format of our PDB-style files is described here.)

Timeline for d1div_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1div_2