![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.97: Cell cycle regulatory proteins [55636] (1 superfamily) beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1243 can form strand-exchange dimers |
![]() | Superfamily d.97.1: Cell cycle regulatory proteins [55637] (1 family) ![]() |
![]() | Family d.97.1.1: Cell cycle regulatory proteins [55638] (5 proteins) |
![]() | Protein CksHs1 [55645] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [55646] (5 PDB entries) |
![]() | Domain d1dksb_: 1dks B: [40690] complexed with po4 |
PDB Entry: 1dks (more details), 3.2 Å
SCOPe Domain Sequences for d1dksb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dksb_ d.97.1.1 (B:) CksHs1 {Human (Homo sapiens) [TaxId: 9606]} kqiyysdkyddeefeyrhvmlpkdiaklvpkthlmsesewrnlgvqqsqgwvhymihepe phillfrrplpkk
Timeline for d1dksb_: