Lineage for d1cksc_ (1cks C:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2208028Fold d.97: Cell cycle regulatory proteins [55636] (1 superfamily)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1243
    can form strand-exchange dimers
  4. 2208029Superfamily d.97.1: Cell cycle regulatory proteins [55637] (1 family) (S)
  5. 2208030Family d.97.1.1: Cell cycle regulatory proteins [55638] (5 proteins)
  6. 2208045Protein CksHs2 [55643] (1 species)
  7. 2208046Species Human (Homo sapiens) [TaxId:9606] [55644] (1 PDB entry)
  8. 2208049Domain d1cksc_: 1cks C: [40685]
    complexed with so4

Details for d1cksc_

PDB Entry: 1cks (more details), 2.1 Å

PDB Description: human ckshs2 atomic structure: a role for its hexameric assembly in cell cycle control
PDB Compounds: (C:) cyclin-dependent kinase subunit, type 2

SCOPe Domain Sequences for d1cksc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cksc_ d.97.1.1 (C:) CksHs2 {Human (Homo sapiens) [TaxId: 9606]}
ahkqiyysdkyfdehyeyrhvmlprelskqvpkthlmseeewrrlgvqqslgwvhymihe
pephillfrrplpkdqqk

SCOPe Domain Coordinates for d1cksc_:

Click to download the PDB-style file with coordinates for d1cksc_.
(The format of our PDB-style files is described here.)

Timeline for d1cksc_: