SCOPe 2.04: Domain d1qb3c_: 1qb3 C:

Lineage for d1qb3c_ (1qb3 C:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.97: Cell cycle regulatory proteins [55636] (1 superfamily)
   beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1243
   can form strand-exchange dimers

4. Superfamily d.97.1: Cell cycle regulatory proteins [55637] (1 family)

5. Family d.97.1.1: Cell cycle regulatory proteins [55638] (5 proteins)

6. Protein cks1 [55641] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55642] (1 PDB entry)

8. Domain d1qb3c_: 1qb3 C: [40682]

Details for d1qb3c_

PDB Entry: 1qb3, 3 Å

PDB Description: crystal structure of the cell cycle regulatory protein cks1

PDB Compounds: (C:) cyclin-dependent kinases regulatory subunit

SCOPe Domain Sequences for d1qb3c_:

Sequence; same for both SEQRES and ATOM records:

>d1qb3c_ d.97.1.1 (C:) cks1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
hafqgrkltdqerarvlefqdsihysprysddnyeyrhvmlpkamlkvipsdyfnsevgt
lriltedewrglgitqslgwehyechapephillfkrplnyeaelraat

Timeline for d1qb3c_:

• d1qb3c_ first appeared (with stable ids) in SCOP 1.55
  
• d1qb3c_ appears in SCOPe 2.03
  
• d1qb3c_ appears in SCOPe 2.05
  
• d1qb3c_ appears in the current release, SCOPe 2.08