Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.96: T-fold [55619] (2 superfamilies) beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234 tunnel-shaped: its known members form wide oligomeric barrels different sizes |
Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families) bind purine or pterin in topologically similar sites between subunits |
Family d.96.1.3: DHN aldolase/epimerase [55628] (2 proteins) beta-sheets of four subunits form a barrel, closed: n=16, S=16 automatically mapped to Pfam PF02152 |
Protein 7,8-dihydroneopterin triphosphate epimerase [55631] (1 species) |
Species Escherichia coli [TaxId:562] [55632] (1 PDB entry) |
Domain d1b9lc_: 1b9l C: [40667] |
PDB Entry: 1b9l (more details), 2.9 Å
SCOPe Domain Sequences for d1b9lc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b9lc_ d.96.1.3 (C:) 7,8-dihydroneopterin triphosphate epimerase {Escherichia coli [TaxId: 562]} aqpaaiiriknlrlrtfigikeeeinnrqdivinvtihypadkartsedindalnyrtvt kniiqhvennrfsllekltqdvldiarehhwvtyaeveidklhalryadsvsmtlswqr
Timeline for d1b9lc_: