Lineage for d5s5md2 (5s5m D:246-441)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958618Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2959091Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2959092Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 2959213Protein automated matches [227071] (7 species)
    not a true protein
  7. 2959219Species Cow (Bos taurus) [TaxId:9913] [226565] (136 PDB entries)
  8. 2959539Domain d5s5md2: 5s5m D:246-441 [406604]
    Other proteins in same PDB: d5s5ma1, d5s5mb1, d5s5mc1, d5s5md1, d5s5me_, d5s5mf1, d5s5mf2, d5s5mf3
    automated match to d3rycd2
    complexed with acp, ca, gdp, gtp, mes, mg, x0s

Details for d5s5md2

PDB Entry: 5s5m (more details), 2.7 Å

PDB Description: tubulin-z45527714-complex
PDB Compounds: (D:) Tubulin beta-2B chain

SCOPe Domain Sequences for d5s5md2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5s5md2 d.79.2.1 (D:246-441) automated matches {Cow (Bos taurus) [TaxId: 9913]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac
dprhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm
satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqdatad

SCOPe Domain Coordinates for d5s5md2:

Click to download the PDB-style file with coordinates for d5s5md2.
(The format of our PDB-style files is described here.)

Timeline for d5s5md2: