Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) |
Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) |
Protein automated matches [227071] (7 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [226565] (136 PDB entries) |
Domain d5s4pd2: 5s4p D:246-441 [406589] Other proteins in same PDB: d5s4pa1, d5s4pb1, d5s4pc1, d5s4pd1, d5s4pe_, d5s4pf1, d5s4pf2, d5s4pf3 automated match to d3rycd2 complexed with acp, ca, gdp, gtp, mes, mg, wny |
PDB Entry: 5s4p (more details), 2.29 Å
SCOPe Domain Sequences for d5s4pd2:
Sequence, based on SEQRES records: (download)
>d5s4pd2 d.79.2.1 (D:246-441) automated matches {Cow (Bos taurus) [TaxId: 9913]} gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac dprhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq qyqdatad
>d5s4pd2 d.79.2.1 (D:246-441) automated matches {Cow (Bos taurus) [TaxId: 9913]} gqlnadlrklavnmvpfprlhffmpgfapltsrgsltvpeltqqmfdsknmmaacdprhg ryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkmsatfi gnstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyqqyqda tad
Timeline for d5s4pd2: