| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) ![]() |
| Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) |
| Protein automated matches [227071] (7 species) not a true protein |
| Species Cow (Bos taurus) [TaxId:9913] [226565] (136 PDB entries) |
| Domain d5s4wa2: 5s4w A:246-438 [406478] Other proteins in same PDB: d5s4wa1, d5s4wb1, d5s4wc1, d5s4wd1, d5s4we_, d5s4wf1, d5s4wf2, d5s4wf3 automated match to d4i50a2 complexed with acp, ca, gdp, gtp, mes, mg, wz7 |
PDB Entry: 5s4w (more details), 2.8 Å
SCOPe Domain Sequences for d5s4wa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5s4wa2 d.79.2.1 (A:246-438) automated matches {Cow (Bos taurus) [TaxId: 9913]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgvd
Timeline for d5s4wa2: