SCOPe 2.08: Domain d5s5uf1: 5s5u F:1-76

Lineage for d5s5uf1 (5s5u F:1-76)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
   3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
   possible rudiment form of Rossmann-fold domain

4. Superfamily c.30.1: PreATP-grasp domain [52440] (10 families)
   precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function

5. Family c.30.1.9: Tubulin tyrosine ligase (TTL) N-terminal domain-like [310625] (1 protein)

6. Protein Tubulin tyrosine ligase (TTL) N-terminal domain [310727] (2 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [311384] (188 PDB entries)

8. Domain d5s5uf1: 5s5u F:1-76 [406365]
   Other proteins in same PDB: d5s5ua1, d5s5ua2, d5s5ub1, d5s5ub2, d5s5uc1, d5s5uc2, d5s5ud1, d5s5ud2, d5s5ue_, d5s5uf2, d5s5uf3
   automated match to d3tiia1
   complexed with acp, ca, gdp, goj, gtp, mes, mg

Details for d5s5uf1

PDB Entry: 5s5u, 2.5 Å

PDB Description: tubulin-z1124201124-complex

PDB Compounds: (F:) Tubulin-tyrosine ligase

SCOPe Domain Sequences for d5s5uf1:

Sequence; same for both SEQRES and ATOM records:

>d5s5uf1 c.30.1.9 (F:1-76) Tubulin tyrosine ligase (TTL) N-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
mytfvvrdenssvyaevsrlllatgqwkrlrkdnprfnlmlgernrlpfgrlghepglvq
lvnyyrgadklcrkas

Timeline for d5s5uf1:

• d5s5uf1 first appeared in SCOPe 2.07