Lineage for d1gtpe_ (1gtp E:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1919500Fold d.96: T-fold [55619] (2 superfamilies)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
    tunnel-shaped: its known members form wide oligomeric barrels different sizes
  4. 1919501Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families) (S)
    bind purine or pterin in topologically similar sites between subunits
  5. 1919502Family d.96.1.1: GTP cyclohydrolase I [55621] (2 proteins)
  6. 1919503Protein GTP cyclohydrolase I [55622] (4 species)
    beta-sheets of five subunits form a barrel, closed: n=20, S=20
  7. 1919504Species Escherichia coli [TaxId:562] [55623] (7 PDB entries)
  8. 1919524Domain d1gtpe_: 1gtp E: [40636]
    complexed with so4

Details for d1gtpe_

PDB Entry: 1gtp (more details), 3 Å

PDB Description: gtp cyclohydrolase i
PDB Compounds: (E:) GTP cyclohydrolase I

SCOPe Domain Sequences for d1gtpe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gtpe_ d.96.1.1 (E:) GTP cyclohydrolase I {Escherichia coli [TaxId: 562]}
pslskeaalvhealvargletplrppvhemdnetrksliaghmteimqllnldladdslm
etphriakmyvdeifsgldyanfpkitlienkmkvdemvtvrditltstcehhfvtidgk
atvayipkdsviglskinrivqffaqrpqvqerltqqilialqtllgtnnvavsidavhy
cvkargirdatsattttslgglfkssqntrheflravrhhn

SCOPe Domain Coordinates for d1gtpe_:

Click to download the PDB-style file with coordinates for d1gtpe_.
(The format of our PDB-style files is described here.)

Timeline for d1gtpe_: