Lineage for d1fbxh_ (1fbx H:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 195160Fold d.96: T-fold [55619] (1 superfamily)
  4. 195161Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (4 families) (S)
  5. 195162Family d.96.1.1: GTP cyclohydrolase I [55621] (1 protein)
  6. 195163Protein GTP cyclohydrolase I [55622] (3 species)
  7. 195164Species Escherichia coli [TaxId:562] [55623] (4 PDB entries)
  8. 195222Domain d1fbxh_: 1fbx H: [40624]

Details for d1fbxh_

PDB Entry: 1fbx (more details), 2.8 Å

PDB Description: crystal structure of zinc-containing e.coli gtp cyclohydrolase i

SCOP Domain Sequences for d1fbxh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fbxh_ d.96.1.1 (H:) GTP cyclohydrolase I {Escherichia coli}
pslskeaalvhealvargletplrppvhemdnetrksliaghmteimqllnldladdslm
etphriakmyvdeifsgldyanfpkitlienkmkvdemvtvrditltstcehhfvtidgk
atvayipkdsviglskinrivqffaqrpqvqerltqqilialqtllgtnnvavsidavhy
cvkargirdatsattttslgglfkssqntrheflravrhhn

SCOP Domain Coordinates for d1fbxh_:

Click to download the PDB-style file with coordinates for d1fbxh_.
(The format of our PDB-style files is described here.)

Timeline for d1fbxh_: