Lineage for d1fbxf_ (1fbx F:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1213557Fold d.96: T-fold [55619] (2 superfamilies)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
    tunnel-shaped: its known members form wide oligomeric barrels different sizes
  4. 1213558Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (4 families) (S)
    bind purine or pterin in topologically similar sites between subunits
  5. 1213559Family d.96.1.1: GTP cyclohydrolase I [55621] (3 proteins)
  6. 1213560Protein GTP cyclohydrolase I [55622] (4 species)
    beta-sheets of five subunits form a barrel, closed: n=20, S=20
  7. 1213561Species Escherichia coli [TaxId:562] [55623] (7 PDB entries)
  8. 1213617Domain d1fbxf_: 1fbx F: [40622]
    zinc-containing active form
    complexed with cl, zn

Details for d1fbxf_

PDB Entry: 1fbx (more details), 2.8 Å

PDB Description: crystal structure of zinc-containing e.coli gtp cyclohydrolase i
PDB Compounds: (F:) GTP cyclohydrolase I

SCOPe Domain Sequences for d1fbxf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fbxf_ d.96.1.1 (F:) GTP cyclohydrolase I {Escherichia coli [TaxId: 562]}
pslskeaalvhealvargletplrppvhemdnetrksliaghmteimqllnldladdslm
etphriakmyvdeifsgldyanfpkitlienkmkvdemvtvrditltstcehhfvtidgk
atvayipkdsviglskinrivqffaqrpqvqerltqqilialqtllgtnnvavsidavhy
cvkargirdatsattttslgglfkssqntrheflravrhhn

SCOPe Domain Coordinates for d1fbxf_:

Click to download the PDB-style file with coordinates for d1fbxf_.
(The format of our PDB-style files is described here.)

Timeline for d1fbxf_: