Lineage for d7op2b_ (7op2 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2776827Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
    sandwich, 10 strands in 2 sheets; greek-key
  4. 2776828Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) (S)
  5. 2776829Family b.21.1.1: Adenovirus fiber protein 'knob' domain [49836] (2 proteins)
    automatically mapped to Pfam PF00541
  6. 2776959Protein automated matches [190333] (6 species)
    not a true protein
  7. 2776990Species Chimpanzee adenovirus y25 [TaxId:1123958] [406124] (1 PDB entry)
  8. 2776992Domain d7op2b_: 7op2 B: [406189]
    automated match to d1knba_
    complexed with ca, edo, trs

Details for d7op2b_

PDB Entry: 7op2 (more details), 1.59 Å

PDB Description: chadox1/ chimpanzee adenovirus y25 fiber knob protein
PDB Compounds: (B:) Fiber

SCOPe Domain Sequences for d7op2b_:

Sequence, based on SEQRES records: (download)

>d7op2b_ b.21.1.1 (B:) automated matches {Chimpanzee adenovirus y25 [TaxId: 1123958]}
kltlwttpdpspncqllsdrdakftlcltkcgsqilgtvavaavtvgsalnpindtvksa
ivflrfdsdgvlmsnssmvgdywnfregqttqsvaytnavgfmpnlgaypktqsktpkns
ivsqvylngettmpmtltitfngtdekdttpvstysmtftwqwtgdykdknitfatnsft
fsymaqe

Sequence, based on observed residues (ATOM records): (download)

>d7op2b_ b.21.1.1 (B:) automated matches {Chimpanzee adenovirus y25 [TaxId: 1123958]}
kltlwttpdpspncqllsdrdakftlcltkcgsqilgtvavaavtvgsalnpindtvksa
ivflrfdsdgvlmsnssmvgdywnfregqttqsvaytnavgfmpnlgaypktqsktpkns
ivsqvylngettmpmtltitfngtpvstysmtftwqwtgdykdknitfatnsftfsymaq
e

SCOPe Domain Coordinates for d7op2b_:

Click to download the PDB-style file with coordinates for d7op2b_.
(The format of our PDB-style files is described here.)

Timeline for d7op2b_: