Lineage for d7nnba_ (7nnb A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2905127Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
    3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest
  4. 2905128Superfamily c.73.1: Carbamate kinase-like [53633] (4 families) (S)
    the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase
  5. 2905281Family c.73.1.0: automated matches [191466] (1 protein)
    not a true family
  6. 2905282Protein automated matches [190728] (15 species)
    not a true protein
  7. 2905405Species Mycobacterium tuberculosis [TaxId:83332] [255987] (18 PDB entries)
  8. 2905412Domain d7nnba_: 7nnb A: [405993]
    automated match to d2v5hf_
    complexed with 97q, edo, so4

Details for d7nnba_

PDB Entry: 7nnb (more details), 2.19 Å

PDB Description: crystal structure of mycobacterium tuberculosis argb in complex with 2,8-bis(trifluoromethyl)quinolin-4-ol.
PDB Compounds: (A:) acetylglutamate kinase

SCOPe Domain Sequences for d7nnba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7nnba_ c.73.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
iealpthikaqvlaealpwlkqlhgkvvvvkyggnamtddtlrrafaadmaflrncgihp
vvvhgggpqitamlrrlgiegdfkggfrvttpevldvarmvlfgqvgrelvnlinahgpy
avgitgedaqlftavrrsvtvdgvatdiglvgdvdqvntaamldlvaagripvvstlapd
adgvvhninadtaaaavaealgaekllmltdidglytrwpdrdslvseidtgtlaqllpt
lesgmvpkveaclraviggvpsahiidgrvthcvlvelftdagtgtkvvrg

SCOPe Domain Coordinates for d7nnba_:

Click to download the PDB-style file with coordinates for d7nnba_.
(The format of our PDB-style files is described here.)

Timeline for d7nnba_: