Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.73: Carbamate kinase-like [53632] (1 superfamily) 3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest |
Superfamily c.73.1: Carbamate kinase-like [53633] (4 families) the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase |
Family c.73.1.0: automated matches [191466] (1 protein) not a true family |
Protein automated matches [190728] (15 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:83332] [255987] (18 PDB entries) |
Domain d7nlxa_: 7nlx A: [405911] automated match to d2v5hf_ complexed with 97w, so4 |
PDB Entry: 7nlx (more details), 2.23 Å
SCOPe Domain Sequences for d7nlxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7nlxa_ c.73.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} ealpthikaqvlaealpwlkqlhgkvvvvkyggnamtddtlrrafaadmaflrncgihpv vvhgggpqitamlrrlgiegdfkggfrvttpevldvarmvlfgqvgrelvnlinahgpya vgitgedaqlftavrrsvtvdgvatdiglvgdvdqvntaamldlvaagripvvstlapda dgvvhninadtaaaavaealgaekllmltdidglytrwpdrdslvseidtgtlaqllptl esgmvpkveaclraviggvpsahiidgrvthcvlvelftdagtgtkvvrg
Timeline for d7nlxa_: