Lineage for d7my2d_ (7my2 D:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2355068Protein automated matches [190119] (22 species)
    not a true protein
  7. 2356330Species Mouse (Mus musculus) [TaxId:10090] [186842] (212 PDB entries)
  8. 2356585Domain d7my2d_: 7my2 D: [405795]
    automated match to d4krpb_
    complexed with nag

Details for d7my2d_

PDB Entry: 7my2 (more details), 2.65 Å

PDB Description: cryoem structure of neutralizing nanobody nb30 in complex with sars- cov2 spike
PDB Compounds: (D:) Nanobody Nb30

SCOPe Domain Sequences for d7my2d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7my2d_ b.1.1.1 (D:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vqlvesggglvqaggslrlscaasgltfskyamgwfrqapgkerkfvatiswsgdsafya
dsvkgrftisrdnarntvylqmnslkpedtavyycaadrgmgygdfmdywgqgtsvtass

SCOPe Domain Coordinates for d7my2d_:

Click to download the PDB-style file with coordinates for d7my2d_.
(The format of our PDB-style files is described here.)

Timeline for d7my2d_: