Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.5: Inosine monophosphate dehydrogenase (IMPDH) [51412] (2 families) The phosphate moiety of substrate binds in the 'common' phosphate-binding site |
Family c.1.5.0: automated matches [227276] (1 protein) not a true family |
Protein automated matches [227084] (16 species) not a true protein |
Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [330485] (6 PDB entries) |
Domain d7mtuc1: 7mtu C:1-486 [405726] Other proteins in same PDB: d7mtua2, d7mtub2, d7mtuc2, d7mtud2, d7mtue2, d7mtuf2, d7mtug2, d7mtuh2 automated match to d5uwxb_ complexed with edo, gol, imp, k, zo7 |
PDB Entry: 7mtu (more details), 2.34 Å
SCOPe Domain Sequences for d7mtuc1:
Sequence, based on SEQRES records: (download)
>d7mtuc1 c.1.5.0 (C:1-486) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]} mweskfvkegltfddvllvpaksdvlprevsvktvlseslqlniplisagmdtvteadma iamarqgglgiihknmsieqqaeqvdkvkrsggllvgaavgvtadamtridalvkasvda ivldtahghsqgvidkvkevrakypslniiagnvataeatkalieaganvvkvgigpgsi cttrvvagvgvpqltavydcatearkhgipviadggikysgdmvkalaagahvvmlgsmf agvaespgeteiyqgrqfkvyrgmgsvgamekgskdryfqegnkklvpegiegrvpykgp ladtvhqlvgglragmgycgaqdleflrenaqfirmsgaglleshphhvqitkeapnys
>d7mtuc1 c.1.5.0 (C:1-486) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]} mweskfvkegltfddvllvpaksdvlprevsvktvlseslqlniplisagmdtvteadma iamarqgglgiihknmsieqqaeqvdkvkrsggllvgaavgvtadamtridalvkasvda ivldtahghsqgvidkvkevrakypslniiagnvataeatkalieaganvvkvgigpgsi cttrvvagvgvpqltavydcatearkhgipviadggikysgdmvkalaagahvvmlgsmf agvaespgeteiyqgrqfkvyrgmgsvgamekklvpegiegrvpykgpladtvhqlvggl ragmgycgaqdleflrenaqfirmsgaglleshphhvqitkeapnys
Timeline for d7mtuc1: