SCOPe 2.08: Domain d7ms7a_: 7ms7 A:

Lineage for d7ms7a_ (7ms7 A:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.44: RING/U-box [57849] (1 superfamily)
   dimetal(zinc)-bound alpha+beta motif; structurally diverse

4. Superfamily g.44.1: RING/U-box [57850] (7 families)

5. Family g.44.1.5: Zf-UBP [161204] (4 proteins)
   Pfam PF02148

6. Protein Ubiquitin carboxyl-terminal hydrolase 5, UBP5 [161207] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [161208] (9 PDB entries)
   Uniprot P45974 169-285

8. Domain d7ms7a_: 7ms7 A: [405633]
   automated match to d2g45a_
   complexed with act, edo, zn, zq1

Details for d7ms7a_

PDB Entry: 7ms7, 1.45 Å

PDB Description: structure of usp5 zinc-finger ubiquitin binding domain co-crystallized with (5-((4-(4-chlorophenyl)piperidin-1-yl)sulfonyl)picolinoyl) glycine

PDB Compounds: (A:) Ubiquitin carboxyl-terminal hydrolase 5

SCOPe Domain Sequences for d7ms7a_:

Sequence; same for both SEQRES and ATOM records:

>d7ms7a_ g.44.1.5 (A:) Ubiquitin carboxyl-terminal hydrolase 5, UBP5 {Human (Homo sapiens) [TaxId: 9606]}
vrqvskhafslkqldnparippcgwkcskcdmrenlwlnltdgsilcgrryfdgsggnnh
avehyretgyplavklgtitpdgadvysydeddmvldpslaehlshfgidmlk

Timeline for d7ms7a_:

• d7ms7a_ first appeared in SCOPe 2.07