SCOPe 2.02: Domain d1hdna_: 1hdn A:

Lineage for d1hdna_ (1hdn A:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.94: HPr-like [55593] (2 superfamilies)
   beta-alpha-beta(2)-alpha-beta-alpha; 2 layers: a/b; antiparallel sheet 1423

4. Superfamily d.94.1: HPr-like [55594] (2 families)

5. Family d.94.1.1: HPr-like [55595] (2 proteins)

6. Protein Histidine-containing phosphocarrier protein (HPr) [55596] (7 species)

7. Species Escherichia coli [TaxId:562] [55599] (14 PDB entries)

8. Domain d1hdna_: 1hdn A: [40562]

Details for d1hdna_

PDB Entry: 1hdn

PDB Description: the high-resolution structure of the histidine-containing phosphocarrier protein hpr from escherichia coli determined by restrained molecular dynamics from nmr nuclear overhauser effect data

PDB Compounds: (A:) histidine-containing phosphocarrier protein hpr

SCOPe Domain Sequences for d1hdna_:

Sequence; same for both SEQRES and ATOM records:

>d1hdna_ d.94.1.1 (A:) Histidine-containing phosphocarrier protein (HPr) {Escherichia coli [TaxId: 562]}
mfqqevtitapnglhtrpaaqfvkeakgftseitvtsngksasakslfklqtlgltqgtv
vtisaegedeqkavehlvklmaele

Timeline for d1hdna_:

• d1hdna_ first appeared (with stable ids) in SCOP 1.55, called d1hdn__
  
• d1hdna_ appears in SCOPe 2.01
  
• d1hdna_ appears in SCOPe 2.03
  
• d1hdna_ appears in the current release, SCOPe 2.08