SCOP 1.71: Domain d1opd__: 1opd -

Lineage for d1opd__ (1opd -)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.94: HPr-like [55593] (2 superfamilies)
   beta-alpha-beta(2)-alpha-beta-alpha; 2 layers: a/b; antiparallel sheet 1423

4. Superfamily d.94.1: HPr-like [55594] (1 family)

5. Family d.94.1.1: HPr-like [55595] (2 proteins)

6. Protein Histidine-containing phosphocarrier protein (HPr) [55596] (7 species)

7. Species Escherichia coli [TaxId:562] [55599] (12 PDB entries)

8. Domain d1opd__: 1opd - [40560]
   complexed with so4; mutant

Details for d1opd__

PDB Entry: 1opd, 1.5 Å

PDB Description: histidine-containing protein (hpr), mutant with ser 46 replaced by asp (s46d)

SCOP Domain Sequences for d1opd__:

Sequence; same for both SEQRES and ATOM records:

>d1opd__ d.94.1.1 (-) Histidine-containing phosphocarrier protein (HPr) {Escherichia coli}
mfeqevtitapnglhtrpaaqfvkeakgftseitvtsngksasakdlfklqtlgltqgtv
vtisaegedeqkavehlvklmaele

Timeline for d1opd__:

• d1opd__ first appeared (with stable ids) in SCOP 1.55
  
• d1opd__ appears in SCOP 1.69
  
• d1opd__ is called d1opda_ in SCOP 1.73
  
• d1opd__ appears in the current release, SCOPe 2.08, called d1opda_